Wolfram|Alpha

Computing...

Input interpretation:

myoglobin  (protein)


Sequence:

GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETL\n...  QSKHPGDFGADAQGAMSKALELFRNDMAAKYKELGFQG


Molecular weight:

17.617 kDa  (kilodaltons)